Protein Labeling Reagents
Cayman Chemical FluoresceIn-5-maleImIde 5mg
An activated fluorescent molecule (excitation: 494 nm, emission: 519 nm) used for labeling proteins; reacts optimally with sulfhydryl groups on cysteine side chains at pH 7, forming a stable thioether bond
American Research Products Inc WATER SOLUBLE LONG ARM BIOTIN
5000265686 WATER SOLUBLE LONG ARM BIOTIN
Cayman Chemical BIotIn-X-NHS 100mg
A compound used to attach biotin to primary amines, such as those found on lysines on the surface of proteins; contains six-atom spacer arm
Bachem 5-Carboxy-fluorescein
5-Carboxy-fluorescein, 76823-03-5, C21H12O7, Mr 376.32, 500mg. 5-FAM, 4-(6-Hydroxy-3-oxo-3H-xanthen-9-yl)-isophthalic acid. Widely used green-fluorescent labeling dye.
Lumiprobe Sulfo-Cyanine7 NHS ester | 1603861-95-5 | MFCD28385520 | 1 mg
Sulfo-Cyanine7 NHS ester | Purity: 95% | Mol Wt: 844.05 | 1603861-95-5 | MFCD28385520 | 1 mg
Sino Biological Recombinant Human DDR1 Protein (His & AVI Tag), HPLC-verified, Endotoxin-Free 20 µg
A DNA sequence encoding the Human DDR1 (NP_001189452.2)(Asp21-Thr416) was expressed with a C-terminal polyhistidine tag followed by an AVI tag. The expressed protein was biotinylated in vivo by the Biotin-Protein ligase (BirA enzyme) which is co-expressed.
Revvity Health Sciences Inc PhenoVue Cell Painting Kit 1 x 384-wells
PhenoVue Cell Painting Kit 1 x 384-wells
AnaSpec D - Luciferin, potassium salt *UltraPure Grade*, 25mg
D-Luciferin, potassium salt *UltraPure Grade*, ; MW 318.41; (25 mg) Luminescent substrate for firefly luciferase.
AnaSpec AMYLOID (1-40) N-TERMINAL
Beta-Amyloid (1-40), Human[DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV] ; MW 4329.9; (0.5 mg) AB (1-40) together with AB (1-42) are two major C-terminal variants of the AB protein constituting the majority of ABs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain.
![eMolecules 16090-02-1 | Fluorescent brightener 71 | Combi-Blocks | MFCD00071913 | 924.920 | C40H38N12Na2O8S2 | 97.000 | [Na+].[Na+].[O-]S(=O)(=O)c1cc(Nc2nc(Nc3ccccc3)nc(n2)N2CCOCC2)ccc1\C=C\c1ccc(Nc2nc(Nc3ccccc3)nc(n2)N2CCOCC2)cc1S([O-])(=O)=O | 1g | 205408224](https://assets.fishersci.com/TFS-Assets/CCG/product-images/502212210.JPG-250.jpg)
eMolecules 16090-02-1 | Fluorescent brightener 71 | Combi-Blocks | MFCD00071913 | 924.920 | C40H38N12Na2O8S2 | 97.000 | [Na+].[Na+].[O-]S(=O)(=O)c1cc(Nc2nc(Nc3ccccc3)nc(n2)N2CCOCC2)ccc1\C=C\c1ccc(Nc2nc(Nc3ccccc3)nc(n2)N2CCOCC2)cc1S([O-])(=O)=O | 1g | 205408224
Fluorescent brightener 71 | Combi-Blocks | 16090-02-1 | MFCD00071913 | 924.920 | C40H38N12Na2O8S2 | 97.000 | [Na+].[Na+].[O-]S(=O)(=O)c1cc(Nc2nc(Nc3ccccc3)nc(n2)N2CCOCC2)ccc1\C=C\c1ccc(Nc2nc(Nc3ccccc3)nc(n2)N2CCOCC2)cc1S([O-])(=O)=O | 1g | 205408224
Cell Signaling Technology Alexa Fluor 555 Phalloidin 300 assays
Alexa Fluor 555 Phalloidin 300 assays